PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA93G00089
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 382aa    MW: 42043.7 Da    PI: 5.123
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA93G00089genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-1760105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd  l + v++ G+++W+tIar ++ gR++k+c++rw + 
       AA93G00089  60 KGPWSPEEDVVLSQFVEKSGPRNWSTIARGIP-GRSGKSCRLRWCNQ 105
                      79******************************.***********985 PP

2Myb_DNA-binding55.91e-17112156147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+ Ed++++ a++ +G++ W++Ia+ ++ gRt++ +k++w++ 
       AA93G00089 112 RNSFTEAEDQKIIAAHAIHGNR-WAAIAKLLP-GRTDNAIKNHWNST 156
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.1155106IPR017930Myb domain
SuperFamilySSF466891.05E-2958153IPR009057Homeodomain-like
SMARTSM007175.1E-1459108IPR001005SANT/Myb domain
PfamPF002496.5E-1660105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2461113IPR009057Homeodomain-like
CDDcd001674.32E-1362104No hitNo description
PROSITE profilePS5129427.326107161IPR017930Myb domain
SMARTSM007172.3E-17111159IPR001005SANT/Myb domain
PfamPF002496.3E-16112156IPR001005SANT/Myb domain
CDDcd001674.49E-13114157No hitNo description
Gene3DG3DSA:1.10.10.603.6E-24114160IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MEEETTKRRP AMTESGRGIS PMEEAAVENM EVGFRGDDDC GGSGGVGDDV TGKRGKERVK  60
GPWSPEEDVV LSQFVEKSGP RNWSTIARGI PGRSGKSCRL RWCNQLDPSL KRNSFTEAED  120
QKIIAAHAIH GNRWAAIAKL LPGRTDNAIK NHWNSTLRRR CIDIEKAKNI ATTENMIIED  180
SIFDRTTTRA SSEETLSSNG GHVTTPHLSS EGKETTSLEI YEEQCADKTN GETMSKQQQE  240
ANDDPQTLFR PVPRFSSFNV YDASSKPVSS PNQTQDPQSS TQDTSMLRLL EEAYSERFVP  300
QKCGRGCCSN PIGTCEKNSL LGPEFIDYLD PPTFPSYELA AIATDISSLA WLRSGLESSS  360
VKVMEEAVGR LMPQSSKGHL AT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-395716155159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-395716155159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407701.11e-170hypothetical protein EUTSA_v10021963mg
TrEMBLV4LZ711e-170V4LZ71_EUTSA; Uncharacterized protein
STRINGscaffold_301043.11e-167(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84922636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-158myb domain protein 1